PDB entry 1xie

View 1xie on RCSB PDB site
Description: modes of binding substrates and their analogues to the enzyme d-xylose isomerase
Deposited on 1994-03-07, released 1994-06-22
The last revision prior to the SCOP 1.55 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1xie__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xie_ (-)
    mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlip
    fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
    rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
    epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
    lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
    asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
    dvdaaaargmaferldqlamdhllgar