PDB entry 1xi8

View 1xi8 on RCSB PDB site
Description: Molybdenum cofactor biosynthesis protein from Pyrococcus furiosus Pfu-1657500-001
Class: Structural genomics, unknown function
Keywords: Structural genomics, Molybdenum cofactor biosynthesis protein, Pyrococcus furiosus, Southeast Collaboratory for Structural Genomics, hyperthermophile, PSI, Protein Structure Initiative, SECSG, unknown function
Deposited on 2004-09-21, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi8a1, d1xi8a2, d1xi8a3
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi8b1, d1xi8b2, d1xi8b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xi8A (A:)
    ahhhhhhgsefkrltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlppf
    draavdgyavraedtfeareyspvelevieevpigenpnkeviagkaikvltggkiprga
    navimqemvkregskiyvlrpvapgqnisfagedvkkgdialkkgtilrpqdlallkalg
    irkvpvkvkpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvv
    pdnedlirsalekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygerv
    fvmsgypvavftqfhlfvkhalaklvgakdyevkvravleddvpsqlgryefvrvmyrdg
    kakvikkkgsgiisslvqsnaylvvpedvegyrrgeevwvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi8A (A:)
    rltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlsfagedvkkgdialk
    kgtilrpqdlallkalgirkvpvkvkpkvgiiitvdtnsimlsalveryfgepilygvvp
    dnedlirsalekakrecdlvlitgfvnllfhgttirpgrpigygervfvmsgypvavftq
    fhlfvkhalaklvgakdyevkvravleddvpsqlgryefvrvmyrdgkakvikkgsgiis
    slvqsnaylvvpedvegyrrgeevwvtly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xi8B (B:)
    ahhhhhhgsefkrltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlppf
    draavdgyavraedtfeareyspvelevieevpigenpnkeviagkaikvltggkiprga
    navimqemvkregskiyvlrpvapgqnisfagedvkkgdialkkgtilrpqdlallkalg
    irkvpvkvkpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvv
    pdnedlirsalekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygerv
    fvmsgypvavftqfhlfvkhalaklvgakdyevkvravleddvpsqlgryefvrvmyrdg
    kakvikkkgsgiisslvqsnaylvvpedvegyrrgeevwvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi8B (B:)
    rltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlsfagedvkkgdialk
    kgtilrpqdlallkalgirkvpvkvkpkvgiiitgdtnsimlsalveryfgepilygvvp
    dnedlirsalekakrecdlvlitgvnllfhgttirpgrpigygervfvmsgypvavftqf
    hlfvkhalaklvgakdyevkvravleddvpsqlgryefvrvmyrdgkakvikkiisslvq
    snaylvvpedvegyrrgeevwvtly