PDB entry 1xi7

View 1xi7 on RCSB PDB site
Description: NMR structure of the carboxyl-terminal cysteine domain of the VHv1.1 polydnaviral gene product
Class: Viral protein
Keywords: cystine knot, antiparallel beta sheet structural scaffold
Deposited on 2004-09-21, released 2004-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-05, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cysteine-rich omega-conotoxin homolog VHv1.1
  Species: Campoletis sonorensis virus
  Gene: pVX900 clone
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q89632
  Domains in SCOP 1.73: d1xi7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1xi7A (A:)
  amvsstcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdggvrglpng
  a
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1xi7A (A:)
  tcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdg