PDB entry 1xi7

View 1xi7 on RCSB PDB site
Description: NMR structure of the carboxyl-terminal cysteine domain of the VHv1.1 polydnaviral gene product
Deposited on 2004-09-21, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xi7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xi7A (A:)
amvsstcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdggvrglpng
a

    Sequence, based on observed residues (ATOM records): (download) 
    >1xi7A (A:)
tcighyqkcvnadkpccsktvrygdsknvrkficdrdgegvcvpfdg