PDB entry 1xi5

View 1xi5 on RCSB PDB site
Description: Clathrin D6 coat with auxilin J-domain
Class: endocytosis/exocytosis
Keywords: clathrin, alpha-zig-zag, beta-propeller, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2004-09-21, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: EM
Resolution: 12 Å
R-factor: N/A
AEROSPACI score: -0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5a_
  • Chain 'B':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5b_
  • Chain 'C':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5c_
  • Chain 'D':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5d_
  • Chain 'E':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5e_
  • Chain 'F':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5f_
  • Chain 'G':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5g_
  • Chain 'H':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5h_
  • Chain 'I':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5i_
  • Chain 'J':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5j_
  • Chain 'K':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5k_
  • Chain 'L':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5l_
  • Chain 'M':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5m_
  • Chain 'N':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5n_
  • Chain 'O':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5o_
  • Chain 'P':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5p_
  • Chain 'Q':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5q_
  • Chain 'R':
    Compound: Auxilin J-domain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi5r_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5A (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5B (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5C (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5D (D:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5E (E:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5F (F:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5G (G:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5H (H:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5I (I:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5J (J:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5K (K:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5L (L:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5M (M:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5N (N:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5O (O:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5P (P:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5Q (Q:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi5R (R:)
    prtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadl
    vtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply