PDB entry 1xi4

View 1xi4 on RCSB PDB site
Description: Clathrin D6 Coat
Class: endocytosis/exocytosis
Keywords: clathrin, alpha-zig-zag, beta-propeller, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2004-09-21, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-04, with a file datestamp of 2011-05-06.
Experiment type: EM
Resolution: 7.9 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4a_
  • Chain 'B':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4b_
  • Chain 'C':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4c_
  • Chain 'D':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4d_
  • Chain 'E':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4e_
  • Chain 'F':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4f_
  • Chain 'G':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4g_
  • Chain 'H':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4h_
  • Chain 'I':
    Compound: clathrin heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4i_
  • Chain 'J':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4j_
  • Chain 'K':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4k_
  • Chain 'L':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4l_
  • Chain 'M':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4m_
  • Chain 'N':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4n_
  • Chain 'O':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4o_
  • Chain 'P':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4p_
  • Chain 'Q':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4q_
  • Chain 'R':
    Compound: Clathrin light chain A
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi4r_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4A (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4B (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4C (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4D (D:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4E (E:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4F (F:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4G (G:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4H (H:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4I (I:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfaetgqvqkivlyakkvgytpdwifllrnvmrispdqgqqfaqmlvqde
    epladitqivdvfmeynliqqctaflldalknnrpsegplqtrllemnlmhapqvadail
    gnqmfthydrahiaqlcekagllqralehftdlydikravvhthllnpewlvnyfgslsv
    edsleclramlsanirqnlqicvqvaskyheqlstqslielfesfksfeglfyflgsivn
    fsqdpdvhfkyiqaacktgqikevericresncydpervknflkeakltdqlpliivcdr
    fdfvhdlvlylyrnnlqkyieiyvqkvnpsrlpvvigglldvdcsedviknlilvvrgqf
    stdelvaevekrnrlklllpwlearihegceepathnalakiyidsnnnperflrenpyy
    dsrvvgkycekrdphlacvayergqcdlelinvcnenslfkslsrylvrrkdpelwgsvl
    lesnpyrrplidqvvqtalsetqdpeevsvtvkafmtadlpneliellekivldnsvfse
    hrnlqnlliltaikadrtrvmeyinrldnydapdianiaisnelfeeafaifrkfdvnts
    avqvliehignldrayefaercnepavwsqlakaqlqkgmvkeaidsyikaddpssymev
    vqaantsgnweelvkylqmarkkaresyvetelifalaktnrlaeleefingpnnahiqq
    vgdrcydekmydaakllynnvsnfgrlastlvhlgeyqaavdgarkanstrtwkevcfac
    vdgkefrlaqmcglhivvhadeleelinyyqdrgyfeelitmleaalglerahmgmftel
    ailyskfkpqkmrehlelfwsrvnipkvlraaeqahlwaelvflydkyeeydnaiitmmn
    hptdawkegqfkdiitkvanvelyyraiqfylefkplllndllmvlsprldhtravnyfs
    kvkqlplvkpylrsvqnhnnksvneslnnlfiteedyqalrtsidaydnfdnislaqrle
    kheliefrriaaylfkgnnrwkqsvelckkdslykdamqyaseskdtelaeellqwflqe
    ekrecfgaclftcydllrpdvvletawrhnimdfampyfiqvmkeyltkvdkldaseslr
    keeeqatetq
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4J (J:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4K (K:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4L (L:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4M (M:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4N (N:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4O (O:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4P (P:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4Q (Q:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xi4R (R:)
    vdrlqsepesirkwreeqterlealdansrkqeaewkekaikeldewyarqdeqlqktka
    nnrvadeafy