PDB entry 1xi3

View 1xi3 on RCSB PDB site
Description: Thiamine phosphate pyrophosphorylase from Pyrococcus furiosus Pfu-1255191-001
Class: transferase
Keywords: structural genomics, Thiamine phosphate pyrophosphorylase, Southeast Collaboratory for Structural Genomics, Pyrococcus furiosus, hyperthermophile, protein structure initiative, PSI, SECSG, transferase
Deposited on 2004-09-21, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine phosphate pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: thiE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi3a_
  • Chain 'B':
    Compound: Thiamine phosphate pyrophosphorylase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: thiE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi3b_
  • Heterogens: SO4, UNX, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xi3A (A:)
    ahhhhhhgsnlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigk
    tlrqltreydalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvyslee
    aleaekkgadylgagsvfptktkedarvigleglrkivesvkipvvaigginkdnarevl
    ktgvdgiavisavmgaedvrkateelrkiveevlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi3A (A:)
    nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
    dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
    dylgagsvfptdarvigleglrkivesvkipvvaigginkdnarevlktgvdgiavisav
    mgaedvrkateelrkiveevlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xi3B (B:)
    ahhhhhhgsnlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigk
    tlrqltreydalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvyslee
    aleaekkgadylgagsvfptktkedarvigleglrkivesvkipvvaigginkdnarevl
    ktgvdgiavisavmgaedvrkateelrkiveevlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi3B (B:)
    nlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltrey
    dalffvddrvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkga
    dylgagsvfptdarvigleglrkivesvkipvvaigginkdnarevlktgvdgiavisav
    mgaedvrkateelrkiveevlg