PDB entry 1xi1

View 1xi1 on RCSB PDB site
Description: Phi29 DNA polymerase ssDNA complex, monoclinic crystal form
Class: transferase/DNA
Keywords: DNA polymerase, protein-primed, strand displacement, processivity, replication, TRANSFERASE/DNA COMPLEX
Deposited on 2004-09-21, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.243
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (4-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xi1a1, d1xi1a2
  • Chain 'B':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (4-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.07: d1xi1b1, d1xi1b2
  • Chain 'C':
    Compound: 5'-d(p*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(p*tp*tp*tp*tp*t)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xi1A (A:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi1A (A:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xi1B (B:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi1B (B:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.