PDB entry 1xi0

View 1xi0 on RCSB PDB site
Description: X-ray crystal structure of wild-type Xerocomus chrysenteron lectin XCL
Class: sugar binding protein
Keywords: beta sandwich, greek key motif, SUGAR BINDING PROTEIN
Deposited on 2004-09-21, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Xerocomus chrysenteron [TaxId:5386]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi0a_
  • Chain 'B':
    Compound: lectin
    Species: Xerocomus chrysenteron [TaxId:5386]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xi0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xi0A (A:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltqggsgtsgvlrfl
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi0A (A:)
    msysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltqggsgtsgvlrflst
    kgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsai
    gtkvevvytvaegnnleanvifs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xi0B (B:)
    ghmsysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltqggsgtsgvlrfl
    stkgeritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvts
    aigtkvevvytvaegnnleanvifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xi0B (B:)
    sysitlrvyqtnrdrgyfsivektvwhfanggtwseangahtltqggsgtsgvlrflstk
    geritvavgvhnykrwcdvvtglkpdetalvinpqyynnggrdyvrekqlaeysvtsaig
    tkvevvytvaegnnleanvifs