PDB entry 1xhz

View 1xhz on RCSB PDB site
Description: Phi29 DNA polymerase, orthorhombic crystal form, ssDNA complex
Class: transferase/DNA
Keywords: DNA polymerase, protein-primed, strand displacement, processivity, replication, TRANSFERASE/DNA COMPLEX
Deposited on 2004-09-21, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.08: d1xhza1, d1xhza2
  • Chain 'B':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.08: d1xhzb1, d1xhzb2
  • Chain 'C':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.08: d1xhzc1, d1xhzc2
  • Chain 'D':
    Compound: DNA polymerase
    Species: BACILLUS PHAGE PHI29 [TaxId:10756]
    Gene: 2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03680 (Start-574)
      • engineered (11)
      • engineered (65)
    Domains in SCOPe 2.08: d1xhzd1, d1xhzd2
  • Chain 'E':
    Compound: 5'-d(*tp*tp*tp*tp*t)-3'
  • Chain 'F':
    Compound: 5'-d(*tp*tp*tp*tp*t)-3'
  • Chain 'G':
    Compound: 5'-d(*tp*tp*tp*tp*t)-3'
  • Chain 'H':
    Compound: 5'-d(*tp*tp*tp*tp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhzA (A:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhzA (A:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhzB (B:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhzB (B:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhzC (C:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhzC (C:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xhzD (D:)
    mkhmprkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyf
    hnlkfagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviy
    dslkklpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliq
    fkqgldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkek
    eigegmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyip
    tiqikrsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglf
    kdfidkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeee
    tkdpvytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkkl
    gywahestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikke
    vtfenfkvgfsrkmkpkpvqvpggvvlvddtftik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhzD (D:)
    prkmyscafetttkvedcrvwaygymniedhseykignsldefmawvlkvqadlyfhnlk
    fagafiinwlerngfkwsadglpntyntiisrmgqwymidiclgykgkrkihtviydslk
    klpfpvkkiakdfkltvlkgdidyhkerpvgykitpeeyayikndiqiiaealliqfkqg
    ldrmtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeige
    gmvfdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqi
    krsrfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfi
    dkwtyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdp
    vytpmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywa
    hestfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfe
    nfkvgfsrkmkpkpvqvpggvvlvddtftik
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.