PDB entry 1xhy

View 1xhy on RCSB PDB site
Description: X-ray structure of the Y702F mutant of the GluR2 ligand-binding core (S1S2J) in complex with kainate at 1.85 A resolution
Class: membrane protein
Keywords: Ionotropic glutamate receptor GluR2, mutant, ligand-binding core, kainate complex, MEMBRANE PROTEIN
Deposited on 2004-09-21, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • linker (117-118)
    • Uniprot P19491 (119-End)
      • engineered mutation (189)
    Domains in SCOPe 2.07: d1xhya_
  • Heterogens: SO4, KAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhyA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhyA (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyafllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgecg