PDB entry 1xhv

View 1xhv on RCSB PDB site
Description: hincii bound to cleaved cognate dna gtcgac and mn2+
Deposited on 2004-09-20, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1xhva_
  • Chain 'B':
    Domains in SCOP 1.69: d1xhvb_
  • Chain 'C':
    Domains in SCOP 1.69: d1xhvc_
  • Chain 'D':
    Domains in SCOP 1.69: d1xhvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhvA (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhvA (A:)
    sfikpiyqdinsiligqkvkrptlsghaagepfeklvykflkenlsdltfkqyeylndlf
    mknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfye
    lldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvs
    tsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqrais
    midkfvkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhvB (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhvB (B:)
    sfikpiyqdinsiligqkvkrpksghaagepfeklvykflkenlsdltfkqyeylndlfm
    knpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyel
    ldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvst
    sfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraism
    idkfvkpfkkyi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhvC (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhvC (C:)
    sfikpiyqdinsiligqkvkrpksggepfeklvykflkenlsdltfkqyeylndlfmknp
    aiighearyklfnsptllfllsrgkaatenwienlfeekqndtadillvkqfyelldvkt
    rnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfael
    fksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfv
    kpfkkyi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xhvD (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhvD (D:)
    sfikpiyqdinsiligqkvkraagepfeklvykflkenlsdltfkqyeylndlfmknpai
    ighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvkt
    rnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfael
    fksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfv
    kpfkkyi