PDB entry 1xhu

View 1xhu on RCSB PDB site
Description: HincII bound to cleaved, cognate DNA containing GTCGAC
Class: hydrolase/DNA
Keywords: restriction endonuclease, phosphoryl transfer, hydrolase-DNA COMPLEX
Deposited on 2004-09-20, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-256)
      • conflict (128)
      • conflict (171)
    Domains in SCOPe 2.08: d1xhua_
  • Chain 'B':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-End)
      • conflict (128)
      • conflict (171)
    Domains in SCOPe 2.08: d1xhub_
  • Chain 'C':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-256)
      • conflict (128)
      • conflict (171)
    Domains in SCOPe 2.08: d1xhuc_
  • Chain 'D':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-End)
      • conflict (128)
      • conflict (171)
    Domains in SCOPe 2.08: d1xhud_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*c)-3'
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 5'-d(p*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*c)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: 5'-d(p*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*c)-3'
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 5'-d(p*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'K':
    Compound: 5'-d(*gp*cp*cp*gp*gp*tp*c)-3'
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: 5'-d(p*gp*ap*cp*cp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xhuA (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhuB (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhuB (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhuC (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhuC (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsifeekqndtadillvkdqfye
    lldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvs
    tsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqrais
    midkfvkpfkkyil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xhuD (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhuD (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.