PDB entry 1xhs

View 1xhs on RCSB PDB site
Description: Solution NMR Structure of Protein ytfP from Escherichia coli. Northeast Structural Genomics Consortium Target ER111.
Class: structural genomics, unknown function
Keywords: ER111, NMR structure, AUTOSTRUCTURE, Northeast Structural Genomics Consortium, NESG, Protein Structure Initiative, PSI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-09-20, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0131 protein ytfP
    Species: Escherichia coli [TaxId:562]
    Gene: ytfP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xhsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhsA (A:)
    mrifvygslrhkqgnshwmtnaqllgdfsidnyqlyslghypgavpgngtvhgevyridn
    atlaeldalrtrggeyarqliqtpygsawmyvyqrpvdglkliesgdwldrdklehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhsA (A:)
    mrifvygslrhkqgnshwmtnaqllgdfsidnyqlyslghypgavpgngtvhgevyridn
    atlaeldalrtrggeyarqliqtpygsawmyvyqrpvdglkliesgdwldrdk