PDB entry 1xho

View 1xho on RCSB PDB site
Description: Chorismate mutase from Clostridium thermocellum Cth-682
Class: structural genomics, unknown function
Keywords: Chorismate mutase, Clostridium thermocellum, Southeast Collaboratory for Structural Genomics, SECSG, protein structure initiative, PSI, structural genomics, unknown function
Deposited on 2004-09-20, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311463
      • modified residue (59)
      • modified residue (93)
      • modified residue (101)
      • modified residue (103)
      • modified residue (119-120)
    Domains in SCOPe 2.08: d1xhoa1, d1xhoa2
  • Chain 'B':
    Compound: chorismate mutase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311463
      • modified residue (59)
      • modified residue (93)
      • modified residue (101)
      • modified residue (103)
      • modified residue (119-120)
    Domains in SCOPe 2.08: d1xhob1, d1xhob2
  • Chain 'C':
    Compound: chorismate mutase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311463 (30-End)
      • modified residue (30)
      • modified residue (59)
      • modified residue (93)
      • modified residue (101)
      • modified residue (103)
      • modified residue (119-120)
    Domains in SCOPe 2.08: d1xhoc1, d1xhoc2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhoA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmvwairgattvsdntadeivaetqkllkem
    aekngleeddiisiiftvtkdldaafpaiaarnmgwtstalmcmneidvpgslekcirvm
    mhvntdkdkkdikhvylngakvlrpdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhoA (A:)
    vwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaa
    rnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhoB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmvwairgattvsdntadeivaetqkllkem
    aekngleeddiisiiftvtkdldaafpaiaarnmgwtstalmcmneidvpgslekcirvm
    mhvntdkdkkdikhvylngakvlrpdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhoB (B:)
    vwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaiaa
    rnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhoC (C:)
    mgsshhhhhhssglvprgsqstslykkaglmvwairgattvsdntadeivaetqkllkem
    aekngleeddiisiiftvtkdldaafpaiaarnmgwtstalmcmneidvpgslekcirvm
    mhvntdkdkkdikhvylngakvlrpdlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhoC (C:)
    mvwairgattvsdntadeivaetqkllkemaekngleeddiisiiftvtkdldaafpaia
    arnmgwtstalmcmneidvpgslekcirvmmhvntdkdkkdikhvylngakvl