PDB entry 1xhn

View 1xhn on RCSB PDB site
Description: The crystal structure of Cellular Repressor of E1A-stimulated Genes (CREG)
Class: unknown function
Keywords: beta-barrel, UNKNOWN FUNCTION
Deposited on 2004-09-20, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular Repressor of E1A-stimulated Genes
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75629 (12-End)
      • expression tag (10-11)
      • modified residue (90)
      • modified residue (114)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.07: d1xhna1, d1xhna2
  • Chain 'B':
    Compound: Cellular Repressor of E1A-stimulated Genes
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75629 (12-End)
      • expression tag (11)
      • modified residue (90)
      • modified residue (114)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.07: d1xhnb2, d1xhnb3
  • Chain 'C':
    Compound: Cellular Repressor of E1A-stimulated Genes
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75629 (12-End)
      • expression tag (11)
      • modified residue (90)
      • modified residue (114)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.07: d1xhnc2, d1xhnc3
  • Chain 'D':
    Compound: Cellular Repressor of E1A-stimulated Genes
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75629 (12-End)
      • expression tag (10-11)
      • modified residue (90)
      • modified residue (114)
      • modified residue (127)
      • modified residue (141)
    Domains in SCOPe 2.07: d1xhnd2, d1xhnd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhnA (A:)
    mgsshhhhhhgslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgpp
    gagsgvpyfylsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtv
    tkvnetemdiakhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyyn
    vtvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhnA (A:)
    gslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfy
    lsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdi
    akhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhnB (B:)
    mgsshhhhhhgslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgpp
    gagsgvpyfylsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtv
    tkvnetemdiakhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyyn
    vtvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhnB (B:)
    slppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyl
    splqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdia
    khslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xhnC (C:)
    mgsshhhhhhgslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgpp
    gagsgvpyfylsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtv
    tkvnetemdiakhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyyn
    vtvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhnC (C:)
    slppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfyl
    splqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdia
    khslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xhnD (D:)
    mgsshhhhhhgslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgpp
    gagsgvpyfylsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtv
    tkvnetemdiakhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyyn
    vtvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhnD (D:)
    gslppredaarvarfvthvsdwgalatistleavrgrpfadvlslsdgppgagsgvpyfy
    lsplqlsvsnlqenpyatltmtlaqtnfckkhgfdpqsplcvhimlsgtvtkvnetemdi
    akhslfirhpemktwpsshnwffaklnitniwvldyfggpkivtpeeyynvt