PDB entry 1xhl

View 1xhl on RCSB PDB site
Description: Crystal Structure of putative Tropinone Reductase-II from Caenorhabditis Elegans with Cofactor and Substrate
Class: oxidoreductase
Keywords: Parallel beta-sheet of seven strands in the order 3214567, three alpha-helices on either side of beta-sheet, seventh alpha-helix on top of beta-sheet, structural genomics, protein structure initiative, SCSG, PSI, Southeast Collaboratory for Structural Genomics, SECSG, OXIDOREDUCTASE
Deposited on 2004-09-20, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase family member (5L265), putative Tropinone Reductase-II
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F25D1.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xhla_
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase family member (5L265), putative Tropinone Reductase-II
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: F25D1.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xhlb_
  • Heterogens: NDP, TNE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhlA (A:)
    mgsshhhhhhssglvprgshmarfsgksviitgssngigrsaavifakegaqvtitgrne
    drleetkqqilkagvpaekinavvadvteasgqddiinttlakfgkidilvnnaganlad
    gtantdqpvelyqktfklnfqaviemtqktkehliktkgeivnvssivagpqahsgypyy
    acakaaldqytrctaidliqhgvrvnsvspgavatgfmgamglpetasdklysfigsrke
    cipvghcgkpeeianiivfladrnlssyiigqsivadggstlvmgmqthdlmsvlsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhlA (A:)
    rfsgksviitgssngigrsaavifakegaqvtitgrnedrleetkqqilkagvpaekina
    vvadvteasgqddiinttlakfgkidilvnnaganladgtantdqpvelyqktfklnfqa
    viemtqktkehliktkgeivnvssivagpqahsgypyyacakaaldqytrctaidliqhg
    vrvnsvspgavatgfmgamglpetasdklysfigsrkecipvghcgkpeeianiivflad
    rnlssyiigqsivadggstlvmgmqthdlmsvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xhlB (B:)
    mgsshhhhhhssglvprgshmarfsgksviitgssngigrsaavifakegaqvtitgrne
    drleetkqqilkagvpaekinavvadvteasgqddiinttlakfgkidilvnnaganlad
    gtantdqpvelyqktfklnfqaviemtqktkehliktkgeivnvssivagpqahsgypyy
    acakaaldqytrctaidliqhgvrvnsvspgavatgfmgamglpetasdklysfigsrke
    cipvghcgkpeeianiivfladrnlssyiigqsivadggstlvmgmqthdlmsvlsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhlB (B:)
    rfsgksviitgssngigrsaavifakegaqvtitgrnedrleetkqqilkagvpaekina
    vvadvteasgqddiinttlakfgkidilvnnaganladgtantdqpvelyqktfklnfqa
    viemtqktkehliktkgeivnvssivagpqahsgypyyacakaaldqytrctaidliqhg
    vrvnsvspgavatgfmgamglpetasdklysfigsrkecipvghcgkpeeianiivflad
    rnlssyiigqsivadggstlvmgmqthdlmsvls