PDB entry 1xhj

View 1xhj on RCSB PDB site
Description: Solution Structure Of The Staphylococcus Epidermidis Protein SE0630. Northest Structural Genomics Consortium Target SeR8.
Class: metal binding protein
Keywords: Alpha-beta, NifU-like, Structural Genomics, Protein Structure Initiative, NESG, PSI, Northeast Structural Genomics Consortium, METAL BINDING PROTEIN
Deposited on 2004-09-20, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrogen Fixation Protein NifU
  Species: Staphylococcus epidermidis [TaxId:176280]
  Gene: SE0936
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8CPV7 (0-79)
    • expression tag (80-87)
  Domains in SCOPe 2.08: d1xhja1, d1xhja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xhjA (A:)
  mptenptmfdqvaevierlrpfllrdggdctlvdvedgivklqlhgacgtcpsstitlka
  gieralheevpgvieveqvflehhhhhh