PDB entry 1xhh

View 1xhh on RCSB PDB site
Description: Solution Structure of porcine beta-microseminoprotein
Deposited on 2004-09-20, released 2005-03-20
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-microseminoprotein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02826 (0-90)
      • see remark 999 (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xhhA (A:)
    qcyfipnqslkpnecqdlkgvshplnsvwktkdceectcgqdaisccntaaiptgydtnk
    cqkilnkktctytvvekkdpgktcdvtgwvl