PDB entry 1xhd

View 1xhd on RCSB PDB site
Description: X-ray crystal structure of putative acetyltransferase, product of BC4754 gene [Bacillus cereus]
Deposited on 2004-09-17, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xhda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhdA (A:)
    snamiypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnv
    qdqctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigag
    slvsqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhdA (A:)
    snamiypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnv
    qdqctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigag
    slvsqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslq