PDB entry 1xhd

View 1xhd on RCSB PDB site
Description: X-ray crystal structure of putative acetyltransferase, product of BC4754 gene [Bacillus cereus]
Class: transferase
Keywords: structural genomics, protein structure initiative, Medwest Center for Structural Genomics, MCSG, Macyltransferase, PSI, Midwest Center for Structural Genomics, TRANSFERASE
Deposited on 2004-09-17, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyltransferase/acyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC4754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q816R4 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (100)
      • modified residue (153)
    Domains in SCOPe 2.08: d1xhda1, d1xhda2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhdA (A:)
    snamiypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnv
    qdqctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigag
    slvsqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhdA (A:)
    snamiypykekkpkiassafiadyvtitgdvyvgeessiwfntvirgdvsptiigdrvnv
    qdqctlhqspqyplileddvtvghqvilhschikkdaligmgsiildgaeigegafigag
    slvsqgkkippntlafgrpakvireltaedrkdmerirtqyvekgqyykslq