PDB entry 1xhc

View 1xhc on RCSB PDB site
Description: NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001
Class: oxidoreductase
Keywords: NADH oxidase, nitrite reductase, Pyrococcus furiosus, Southeast Collaboratory for Structural Genomics, SECSG, hyperthermophile, protein structure initiative, PSI, PSI, Protein Structure Initiative
Deposited on 2004-09-17, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH oxidase /nitrite reductase
    Species: Pyrococcus furiosus DSM 3638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U1K9 (9-End)
      • his tag (8)
    Domains in SCOP 1.73: d1xhca1, d1xhca2, d1xhca3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhcA (A:)
    ahhhhhhgskvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprn
    rlfpysldwyrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgararepqikg
    keylltlrtifdadrikesiensgeaiiigggfiglelagnlaeagyhvklihrgamflg
    ldeelsnmikdmleetgvkfflnselleaneegvltnsgfiegkvkicaigivpnvdlar
    rsgihtgrgiliddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkgeprr
    ynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkatklek
    eildfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhcA (A:)
    skvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprnrlfpysld
    wyrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgararepqikgkeylltlr
    tifdadrikesiensgeaiiigggfiglelagnlaeagyhvklihrgamflgldeelsnm
    ikdmleetgvkfflnselleaneegvltnsgfiegkvkicaigivpnvdlarrsgihtgr
    giliddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkgeprrynfkfrst
    vfkfgklqiaiigntkgegkwiedntkvfyigavvfndirkatkle