PDB entry 1xhc

View 1xhc on RCSB PDB site
Description: nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
Deposited on 2004-09-17, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xhcA (A:)
    ahhhhhhgskvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprn
    rlfpysldwyrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgararepqikg
    keylltlrtifdadrikesiensgeaiiigggfiglelagnlaeagyhvklihrgamflg
    ldeelsnmikdmleetgvkfflnselleaneegvltnsgfiegkvkicaigivpnvdlar
    rsgihtgrgiliddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkgeprr
    ynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndirkatklek
    eildfys
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xhcA (A:)
    skvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprnrlfpysld
    wyrkrgieirlaeeaklidrgrkvvitekgevpydtlvlatgararepqikgkeylltlr
    tifdadrikesiensgeaiiigggfiglelagnlaeagyhvklihrgamflgldeelsnm
    ikdmleetgvkfflnselleaneegvltnsgfiegkvkicaigivpnvdlarrsgihtgr
    giliddnfrtsakdvyaigdcaeysgiiagtakaameqarvladilkgeprrynfkfrst
    vfkfgklqiaiigntkgegkwiedntkvfyigavvfndirkatkle