PDB entry 1xha

View 1xha on RCSB PDB site
Description: Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein Kinase A and Mutants
Class: transferase/transferase inhibitor
Keywords: PKA, kinase-inhibitor-complex, serine/threonine-protein kinase, balanol derivative
Deposited on 2004-09-17, released 2005-09-17
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.223
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
  Species: BOS TAURUS
  Gene: PRKACA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00517 (0-349)
    • engineered (83)
    • engineered (122)
    • engineered (172)
    • engineered (186)
    • modified residue (196)
    • modified residue (337)
  Domains in SCOP 1.75: d1xhaa1
• Chain 'B':
  Compound: cAMP-dependent protein kinase inhibitor, alpha form
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61925 (0-19)
• Heterogens: R68, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xhaA (A:)
  gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
  khmetgnhyamkildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvm
  eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi
  qvtdfglakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
  dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
  dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
  

  
  
• Chain 'B':
  No sequence available.