PDB entry 1xha

View 1xha on RCSB PDB site
Description: Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein Kinase A and Mutants
Class: transferase/transferase inhibitor
Keywords: PKA, kinase-inhibitor-complex, serine/threonine-protein kinase, balanol derivative, TRANSFERASE/TRANSFERASE INHIBITOR COMPLEX
Deposited on 2004-09-17, released 2005-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (0-349)
      • engineered (83)
      • engineered (122)
      • engineered (172)
      • engineered (186)
      • modified residue (196)
      • modified residue (337)
    Domains in SCOPe 2.07: d1xhaa_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: R68, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xhaA (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkeiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyapggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyi
    qvtdfglakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.