PDB entry 1xh6

View 1xh6 on RCSB PDB site
Description: Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein Kinase A and Mutants
Class: transferase/transferase inhibitor
Keywords: PKA, kinase-inhibitor-complex, serine/threonine-protein kinase, balanol derivative, TRANSFERASE/TRANSFERASE INHIBITOR COMPLEX
Deposited on 2004-09-17, released 2005-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKACA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • modified residue (196)
      • modified residue (337)
    Domains in SCOPe 2.07: d1xh6a_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: R94, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xh6A (A:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xh6A (A:)
    flakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkildkq
    kvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrrigr
    fsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgrtwt
    lcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkvrf
    pshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfipk
    fkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.