PDB entry 1xh0

View 1xh0 on RCSB PDB site
Description: Structure of the N298S variant of human pancreatic alpha-amylase complexed with acarbose
Class: hydrolase
Keywords: Chloride Amylase Enzyme Acarbose inhibitor
Deposited on 2004-09-17, released 2005-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase, pancreatic
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04746 (0-495)
      • modified residue (0)
      • engineered (297)
    Domains in SCOP 1.73: d1xh0a1, d1xh0a2
  • Heterogens: NAG, AAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xh0A (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdshd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl