PDB entry 1xgy

View 1xgy on RCSB PDB site
Description: Crystal Structure of Anti-Meta I Rhodopsin Fab Fragment K42-41L
Class: immune system
Keywords: Meta-I, Rhodopsin, Fab, Igg, K42-41L, Phage display, antibody, immunoglobulin, antibody imprinting, peptide mimetics, immune system
Deposited on 2004-09-17, released 2005-09-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.233
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: K42-41L Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xgyh1
  • Chain 'I':
    Compound: K42-41L Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xgyi1
  • Chain 'L':
    Compound: K42-41L Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XGY (0-215)
  • Chain 'M':
    Compound: K42-41L Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XGY (0-215)
  • Chain 'P':
    Compound: Rhodopsin Epitope Mimetic Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XGY (0-End)
  • Chain 'Q':
    Compound: Rhodopsin Epitope Mimetic Peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XGY (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xgyH (H:)
    qvqlqqsgpelvrpgasvkisckasgytftdyyinwvkqrpgqglewigwifprngntky
    nekfkgkatltvdkssstafmqlssltsedsavyfcattvsyvmdywgqgttvtvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgyH (H:)
    qvqlqqsgpelvrpgasvkisckasgytftdyyinwvkqrpgqglewigwifprngntky
    nekfkgkatltvdkssstafmqlssltsedsavyfcattvsyvmdywgqgttvtvssakt
    tppsvyplapgsatnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xgyI (I:)
    qvqlqqsgpelvrpgasvkisckasgytftdyyinwvkqrpgqglewigwifprngntky
    nekfkgkatltvdkssstafmqlssltsedsavyfcattvsyvmdywgqgttvtvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgyI (I:)
    qvqlqqsgpelvrpgasvkisckasgytftdyyinwvkqrpgqglewigwifprngntky
    nekfkgkatltvdkssstafmqlssltsedsavyfcattvsyvmdywgqgttvtvssakt
    tppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.