PDB entry 1xgw

View 1xgw on RCSB PDB site
Description: The crystal structure of human enthoprotin N-terminal domain
Deposited on 2004-09-17, released 2005-09-27
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epsin 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPN4, EPNR, ENTH, KIAA0171
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xgwA (A:)
    gsshhhhhhgsmlnmwkvrelvdkatnvvmnyseieskvreatnddpwgpsgqlmgeiak
    atfmyeqfpelmnmlwsrmlkdnkknwrrvyksllllaylirngservvtsarehiydlr
    slenyhfvdehgkdqginirqkvkelvefaqdddrlreerkkakknkdkyvgvssd
    

    Sequence, based on observed residues (ATOM records):
    >1xgwA (A:)
    vvmnyseieskvreatnddpwgpsgqlmgeiakatfmyeqfpelmnmlwsrmlkdnkknw
    rrvyksllllaylirngservvtsarehiydlrslenyhfvdehgkdqginirqkvkelv
    efaqdddrlreerkka