PDB entry 1xgv

View 1xgv on RCSB PDB site
Description: Isocitrate Dehydrogenase from the hyperthermophile Aeropyrum pernix
Class: oxidoreductase
Keywords: Native enzyme, disulphide-bond, OXIDOREDUCTASE
Deposited on 2004-09-17, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: BAA79665
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xgva_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: BAA79665
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xgvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xgvA (A:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgvA (A:)
    sppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkv
    yggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvai
    rqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfl
    aeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafm
    rwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqviva
    pnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsas
    lligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayidead
    lnevlagkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xgvB (B:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgvB (B:)
    ppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkvy
    ggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpslnvairqaldly
    anirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrflaeefgis
    iredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmrwayeva
    lekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivapnlngdy
    isdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsaslligefm
    gwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadlnevlag