PDB entry 1xgs

View 1xgs on RCSB PDB site
Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Class: aminopeptidase
Keywords: aminopeptidase, hyperthermophile
Deposited on 1997-04-25, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.187
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xgsa1, d1xgsa2
  • Chain 'B':
    Compound: Methionine aminopeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xgsb1, d1xgsb2
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgsA (A:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgsB (B:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte