PDB entry 1xgn

View 1xgn on RCSB PDB site
Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus
Deposited on 1997-11-17, released 1998-02-25
The last revision prior to the SCOP 1.67 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.156
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgnA (A:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgnB (B:)
    mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
    ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
    varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
    gdvfaiepfatigagqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwl
    qndmpegqlklalktlekagaiygypvlkeirngivaqfehtiivekdsvivtte