PDB entry 1xge

View 1xge on RCSB PDB site
Description: Dihydroorotase from Escherichia coli: Loop Movement and Cooperativity between subunits
Class: hydrolase
Keywords: TIM barrel, Hydrolase
Deposited on 2004-09-17, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Escherichia coli [TaxId:562]
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05020
      • modified residue (101)
      • conflict (118)
    Domains in SCOPe 2.07: d1xgea1
  • Chain 'B':
    Compound: dihydroorotase
    Species: Escherichia coli [TaxId:562]
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05020
      • modified residue (101)
      • conflict (118)
    Domains in SCOPe 2.07: d1xgeb_
  • Heterogens: ZN, DOR, NCD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xgeA (A:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfnrvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgeA (A:)
    sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
    davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
    pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
    adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
    rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
    glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xgeB (B:)
    tapsqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrq
    rildavpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvd
    aimpvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehitt
    kdaadyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvas
    gfnrvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngp
    qfyglpvndtfielvreeqqvaesialtddtlvpflagetvrwsvkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xgeB (B:)
    sqvlkirrpddwhlhlrdgdmlktvvpytseiygraivmpnlappvttveaavayrqril
    davpaghdftplmtcyltdsldpnelergfnegvftaaklypanattnsshgvtsvdaim
    pvlermekigmpllvhgevthadidifdrearfiesvmeplrqrltalkvvfehittkda
    adyvrdgnerlaatitpqhlmfnrnhmlvggvrphlyclpilkrnihqqalrelvasgfn
    rvflgtdsapharhrkesscgcagcfnaptalgsyatvfeemnalqhfeafcsvngpqfy
    glpvndtfielvreeqqvaesialtddtlvpflagetvrwsvk