PDB entry 1xgd

View 1xgd on RCSB PDB site
Description: Apo R268A human aldose reductase
Class: oxidoreductase
Keywords: AKR, AKR1B1, NADPH, diabetes, OXIDOREDUCTASE
Deposited on 2004-09-16, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B1, ALDR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-314)
      • engineered (267)
    Domains in SCOPe 2.07: d1xgda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xgdA (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtpeaiaenfkvfdfelssqdmttllsynrnwrvcal
    lsctshkdypfheef