PDB entry 1xg9

View 1xg9 on RCSB PDB site
Description: Methionyl-tRNA formyltransferase from Clostridium thermocellum
Class: transferase
Keywords: Methionyl-tRNA formyltransferase, Southeast Collaboratory for Structural Genomics, SECSG, Clostridium thermocellum, protein structure initiative, PSI, PSI, Protein Structure Initiative
Deposited on 2004-09-16, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-05-03, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA formyltransferase
    Species: Clostridium thermocellum
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00313263 (30-End)
      • his tag (29)
      • modified residue (30)
      • modified residue (104)
      • modified residue (160)
      • modified residue (170)
      • modified residue (216)
      • modified residue (241)
    Domains in SCOPe 2.07: d1xg9a3, d1xg9a4, d1xg9a5
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xg9A (A:)
    mgsshhhhhhssglvprgsqstslykkaglmniiiattkswniknaqkfkkeneskyntt
    iitnkdeltfekvklinpeyilfphwswiipkeifenftcvvfhmtdlpfgrggsplqnl
    iergikktkisaikvdggidtgdiffkrdldlygtaeeifmraskiifndmipelltkrp
    vpqkqegeatvfqrrkpeqseispdfdlekiydyirmldgegyprafikygkyrlefsra
    smkngkiiadveiiegdene
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg9A (A:)
    lmniiiattkswniknaqkfkkeneskynttiitnkdeltfekvklinpeyilfphwswi
    ipkeifenftcvvfhmtdlpfgrggsplqnliergikktkisaikvdggidtgdiffkrd
    ldlygtaeeifmraskiifndmipelltkrpvpqkqegeatvfqrrkpeqseispdfdle
    kiydyirmldgegyprafikygkyrlefsrasmkngkiiadveiieg