PDB entry 1xg8

View 1xg8 on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function SA0789 from Staphylococcus aureus
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein Structure Initative, MCSG, Staphylococcus aureus, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-09-16, released 2004-11-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein SA0798
  Species: Staphylococcus aureus subsp. aureus N315 [TaxId:158879]
  Gene: GI:1123613
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7A6J8 (10-110)
    • cloning artifact (0-9)
  Domains in SCOPe 2.03: d1xg8a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1xg8A (A:)
  anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdnd
  nltdhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1xg8A (A:)
  anlyfqsnavvvygadvicascvnaptskdiydwlqpllkrkypnisfkytyiditkdlt
  dhdlqfierieqdelfyplitmndeyvadgyiqtkqitrfidqklvne