PDB entry 1xg7

View 1xg7 on RCSB PDB site
Description: Conserved hypothetical protein Pfu-877259-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Conserved hypothetical protein, Southeast Collaboratory for Structural Genomics, SECSG, hyperthermophile, Pyrococcus furiosus, protein structure initiative, PSI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-09-16, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2D5 (9-249)
      • expression tag (5-8)
    Domains in SCOPe 2.07: d1xg7a1, d1xg7a2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xg7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xg7A (A:)
    ahhhhhhgsrelveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslv
    syqltgrgedwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegfls
    tltlkdlegyyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeip
    ipedlriksvtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnk
    lmkltellgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg7A (A:)
    hhgsrelveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqlt
    grgedwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlk
    dlegyyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedl
    riksvtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmklt
    ellgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xg7B (B:)
    ahhhhhhgsrelveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslv
    syqltgrgedwwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegfls
    tltlkdlegyyknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeip
    ipedlriksvtskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnk
    lmkltellgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg7B (B:)
    elveiikgigiegakeveekvdrqfyalqylfrhqdpemfiklvianslvsyqltgrged
    wwwefaryfsgrevdsiwkaygeflpksknnrrlieaklnrirkvegflstltlkdlegy
    yknmkmlwkalikimgsredsktivftvkmfgyasriafsrfipypmeipipedlriksv
    tskltqekptkfwmkigqesgvpplhidsliwpllgnadltpldielrnklmkltellg