PDB entry 1xg6

View 1xg6 on RCSB PDB site
Description: The crystal structure of the P1 mutant (Leu to Arg)of a Winged bean chymotrypsin inhibitor(Kunitz)solved at 2.15A resolution
Class: Hydrolase Inhibitor
Keywords: trypsin inhibitor, Hydrolase Inhibitor
Deposited on 2004-09-16, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin inhibitor 3
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822 (4-End)
      • cloning artifact (0-3)
      • engineered (68)
    Domains in SCOPe 2.08: d1xg6a1, d1xg6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xg6A (A:)
    gshmdddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskge
    pirissqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilv
    fkfekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkak
    setassh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg6A (A:)
    gshmdddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskge
    pirissqfrslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilv
    fkfekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllka