PDB entry 1xg4

View 1xg4 on RCSB PDB site
Description: Crystal Structure of the C123S 2-Methylisocitrate Lyase Mutant from Escherichia coli in complex with the inhibitor isocitrate
Class: lyase
Keywords: 2-methylisocitrate lyase/inhibitor complex, isocitrate, isocitrate lyase superfamily
Deposited on 2004-09-16, released 2005-03-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: prpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77541 (0-End)
      • engineered (121)
    Domains in SCOPe 2.03: d1xg4a_
  • Chain 'B':
    Compound: Probable methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: prpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77541
      • engineered (121)
    Domains in SCOPe 2.03: d1xg4b_
  • Chain 'C':
    Compound: Probable methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: prpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77541
      • engineered (121)
    Domains in SCOPe 2.03: d1xg4c_
  • Chain 'D':
    Compound: Probable methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Gene: prpB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77541
      • engineered (121)
    Domains in SCOPe 2.03: d1xg4d_
  • Heterogens: MG, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xg4A (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rsghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg4A (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rsghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xg4B (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rsghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg4B (B:)
    lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
    tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
    sghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
    emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
    mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xg4C (C:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rsghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg4C (C:)
    lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
    tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
    sghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
    emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
    mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xg4D (D:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rsghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg4D (D:)
    lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
    tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
    sghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
    emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
    mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeek