PDB entry 1xg2

View 1xg2 on RCSB PDB site
Description: Crystal structure of the complex between pectin methylesterase and its inhibitor protein
Class: hydrolase/hydrolase inhibitor
Keywords: protein-protein complex, beta helix,four helix bundle, hydrolase/hydrolase inhibitor complex
Deposited on 2004-09-16, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pectinesterase 1
    Species: Solanum lycopersicum [TaxId:4081]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xg2a_
  • Chain 'B':
    Compound: Pectinesterase inhibitor
    Species: Actinidia chinensis [TaxId:3625]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83326 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1xg2b1, d1xg2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xg2A (A:)
    iianavvaqdgtgdyqtlaeavaaapdksktryviyvkrgtykenvevasnkmnlmivgd
    gmyattitgslnvvdgsttfrsatlaavgqgfilqdiciqntagpakdqavalrvgadms
    vinrcridayqdtlyahsqrqfyrdsyvtgtvdfifgnaavvfqkcqlvarkpgkyqqnm
    vtaqgrtdpnqatgtsiqfcniiassdlepvlkefptylgrpwkeysrtvvmesylggli
    npagwaewdgdfalktlyygefmnngpgagtskrvkwpgyhvitdpakampftvakliqg
    gswlrstgvayvdglyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xg2B (B:)
    fenhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiaslt
    nqatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfe
    gppniptqlhqadlkledlcdivlvisnllpgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg2B (B:)
    fenhliseicpktrnpslclqalesdprsaskdlkglgqfsidiaqasakqtskiiaslt
    nqatdpklkgryetcsenyadaidslgqakqfltsgdynslniyasaafdgagtcedsfe
    gppniptqlhqadlkledlcdivlvisnllp