PDB entry 1xg1

View 1xg1 on RCSB PDB site
Description: Solution structure of Myb-domain of human TRF2
Class: DNA binding protein
Keywords: helix-turn-helix
Deposited on 2004-09-16, released 2005-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15554 (4-66)
      • cloning artifact (0-3)
    Domains in SCOP 1.73: d1xg1a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xg1A (A:)
    gshmedsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrt
    mkrlgmn