PDB entry 1xg1

View 1xg1 on RCSB PDB site
Description: Solution structure of Myb-domain of human TRF2
Class: DNA binding protein
Keywords: helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2004-09-16, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: telomeric repeat binding factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15554 (4-66)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d1xg1a1, d1xg1a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xg1A (A:)
    gshmedsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrt
    mkrlgmn