PDB entry 1xfw

View 1xfw on RCSB PDB site
Description: Crystal structure of anthrax edema factor (EF) in complex with calmodulin and 3'5' cyclic AMP (cAMP)
Class: lyase/metal binding protein
Keywords: protein-protein interaction, LYASE-METAL BINDING PROTEIN COMPLEX
Deposited on 2004-09-15, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: calmodulin-sensitive adenylate cyclase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cya
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfwo1
  • Chain 'P':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfwp1
  • Chain 'Q':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfwq1
  • Chain 'R':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfwr1
  • Chain 'S':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfws1
  • Chain 'T':
    Compound: Calmodulin 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfwt1
  • Heterogens: MG, CMP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1xfwO (O:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwO (O:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1xfwP (P:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwP (P:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1xfwQ (Q:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwQ (Q:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1xfwR (R:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwR (R:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1xfwS (S:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwS (S:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1xfwT (T:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
    evdqmireadidgdgqvnyeefvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfwT (T:)
    qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevd
    qmireadidgdgqvnyeefvqmmtak