PDB entry 1xfs

View 1xfs on RCSB PDB site
Description: X-Ray Crystal Structure of Protein NE0264 from Nitrosomonas europaea. Northeast Structural Genomics Consortium Target NeR5.
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, NESG, alpha-beta protein, PSI, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-09-15, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Nitrosomonas europaea [TaxId:228410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82XK1 (Start-169)
      • modified residue (12)
      • modified residue (62)
      • modified residue (113)
      • modified residue (133)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xfsa_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Nitrosomonas europaea [TaxId:228410]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82XK1
      • modified residue (12)
      • modified residue (62)
      • modified residue (113)
      • modified residue (133)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xfsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfsA (A:)
    msttpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefy
    tvmqdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtaviel
    qptssgtrytacamhntpgqrklheemgfhegwgttitqleellkqekaylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfsA (A:)
    idaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvmqd
    pegnkfpnsgcflevtdekrliwtsalvknyrpavpvmtavielqptssgtrytacamhn
    tpgqrklheemgfhegwgttitqleellkqekay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xfsB (B:)
    msttpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefy
    tvmqdpegnkfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtaviel
    qptssgtrytacamhntpgqrklheemgfhegwgttitqleellkqekaylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfsB (B:)
    tpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvm
    qdpegnkfpnsgcflevtdekrliwtsalvknyrpavpivmtavielqptssgtrytaca
    mhntpgqrklheemgfhgwgttitqleellkqek