PDB entry 1xfr

View 1xfr on RCSB PDB site
Description: Solution structure of the Bombyx mori pheromone-binding protein fragment BmPBP(1-128) at pH 6.5
Class: transport protein
Keywords: insect odorant-binding protein, bombyx mori pheromone-binding protein, bmpbpb, alpha-helical transport protein, truncated fragment bmpbp(1-128)
Deposited on 2004-09-15, released 2005-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone-binding protein
  Species: Bombyx mori [TaxId:7091]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34174 (0-127)
  Domains in SCOPe 2.07: d1xfra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xfrA (A:)
  sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
  mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
  eihklnwa