PDB entry 1xfr

View 1xfr on RCSB PDB site
Description: Solution structure of the Bombyx mori pheromone-binding protein fragment BmPBP(1-128) at pH 6.5
Class: transport protein
Keywords: insect odorant-binding protein, bombyx mori pheromone-binding protein, bmpbpb, alpha-helical transport protein, truncated fragment bmpbp(1-128), transport protein
Deposited on 2004-09-15, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xfra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xfrA (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwa