PDB entry 1xfn

View 1xfn on RCSB PDB site
Description: NMR structure of the ground state of the photoactive yellow protein lacking the N-terminal part
Class: signaling protein
Keywords: pas domain, signaling protein
Deposited on 2004-09-15, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfna_
  • Heterogens: HC4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfnA (A:)
    hhhhhhesddddklafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctds
    pefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfnA (A:)
    lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
    gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv