PDB entry 1xfl

View 1xfl on RCSB PDB site
Description: Solution Structure of Thioredoxin h1 from Arabidopsis Thaliana
Deposited on 2004-09-15, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1xfla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xflA (A:)
    mghhhhhhlemaseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapff
    adlakklpnvlflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstia
    khla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xflA (A:)
    maseegqviachtvetwneqlqkanesktlvvvdftaswcgpcrfiapffadlakklpnv
    lflkvdtdelksvasdwaiqamptfmflkegkildkvvgakkdelqstiakhla