PDB entry 1xfk

View 1xfk on RCSB PDB site
Description: 1.8A crsytal strucutre of formiminoglutamase from Vibrio cholerae O1 biovar eltor str. N16961
Class: hydrolase
Keywords: formiminoglutamase protein, Vibrio cholerae O1 biovar eltor, structure genomics, protein structure initiative, MCSG, The Midwest Center for Structural Genomics, PSI, HYDROLASE
Deposited on 2004-09-14, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formimidoylglutamase
    Species: Vibrio cholerae [TaxId:666]
    Gene: hutG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xfka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfkA (A:)
    mnpnfttehtwqgrhdpedgqagrrvhhiacpiqvgelanqepgvaligfecdagvernk
    grtgakhapslikqalanlawhhpipiydlgnircegdeleqaqqecaqviqqalphara
    ivlgggheiawatfqglaqhflatgvkqprigiinfdahfdlrtfeselapvrpssgtpf
    nqihhfcqqqgwdfhyaclgvsrasntpalferadklgvwyvedkafsplslkdhltqlq
    hfiddcdylyltidldvfpaasapgvsapaargvslealapyfdrilhyknklmiadiae
    ynpsfdidqhtarlaarlcwdianamaeqvqsirhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfkA (A:)
    twqgrhdpedgqagrrvhhiacpiqvgelanqepgvaligfecdagvernkgrtgakhap
    slikqalanlawhhpipiydlgnircegdeleqaqqecaqviqqalpharaivlggghei
    awatfqglaqhflatgvkqprigiinfdahfdlrtfeselapvrpssgtpfnqihhfcqq
    qgwdfhyaclgvsrasntpalferadklgvwyvedkafsplslkdhltqlqhfiddcdyl
    yltidldvfpaasapgvsapaargvslealapyfdrilhyknklmiadiaeynpsfdidq
    htarlaarlcwdianamaeqvqsi