PDB entry 1xfj

View 1xfj on RCSB PDB site
Description: Crystal structure of protein CC_0490 from Caulobacter crescentus, Pfam DUF152
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein structure initiative (PSI), Hypothetical protein, alpha-beta-beta-alpha, two-domain structure, New York SGX Research Center for Structural Genomics, NYSGXRC, unknown function
Deposited on 2004-09-14, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.7500000000000002 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Caulobacter vibrioides [TaxId:155892]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AAV3
      • modified residue (109)
      • modified residue (148)
    Domains in SCOPe 2.08: d1xfja_
  • Heterogens: ACT, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xfjA (A:)
    mktpalptvqspllsslpgvkhafftrqggvskgiydslnvgrgsqdepadveenraria
    rwfgggpedlnvcyqihstiaivadgswgdarpegdavvsktpgvicgamaadcapvllv
    dpearivaaahagwrgaldgvvqsavdrmvelgaspanitgvvgpcigpksyevgleflh
    rfeadcpgsgrffkpgasedkrffdlpafvldrlatagverrewvgrdtraeeewffsnr
    raflnndgdygrllsaitlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xfjA (A:)
    alptvqspllsslpgvkhafftrqggvskgiydslnvgrgsqdepadveenrariarwfg
    ggpedlnvcyqihstiaivadgswgdarpegdavvsktpgvicgamaadcapvllvdpea
    rivaaahagwrgaldgvvqsavdrmvelgaspanitgvvgpcigpksyevgleflhrfea
    dcpgsgrffkpgasedkrffdlpafvldrlatagverrewvgrdtraeeewffsnrrafl
    nndgdygrllsaitle